SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3XRQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3XRQ6
Domain Number 1 Region: 10-192,321-403
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 6.83e-63
Family Bacterial dinuclear zinc exopeptidases 0.00063
Further Details:      
 
Domain Number 2 Region: 192-320
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 0.00000000000000718
Family Bacterial exopeptidase dimerisation domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3XRQ6
Sequence length 410
Comment (tr|I3XRQ6|I3XRQ6_DESAM) Acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase {ECO:0000313|EMBL:AFL66630.1} KW=Complete proteome OX=768672 OS=Desulfurococcus amylolyticus DSM 16532. GN=Desfe_0731 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MTISQIYEIAKKILVDSIKFPTVLGEAYEDMIDYYREQLSEYGIHVTIHRVPDEFLRKTL
PREFNPEKPRFILLARIGNGEKVLQFNGHYDVVSPGEGWEMPPFEPVVRDDLVYGRGATD
MKGGIASILTALISLVQERREPSVIIEVALVPDEEIGGRTGTGYLVNELGSRPDYVIIAE
PSGLDNMYIGHRGNVWGIIRVHGKQAHGSAPWLGDNAFEKMLVFAQEFLKRYRERVSSRK
SNYLYEDERAAYPTITPGGLLIAPGSINIVPGTAGFSIDRRLIVEERVEDVIGEIQELLG
QVSRELNIDSSFTLVESSPPAFTPPDNKYTQILGEIIRKNTGREPRKTICIGGLDLRYYT
IKGIPAVSYGPGEVGLAHKPNEHIRISDVVRVSKIYVDFAKRFEKIQVDT
Download sequence
Identical sequences I3XRQ6
WP_014767530.1.2099 gi|390938467|ref|YP_006402205.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]