SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3XSJ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3XSJ3
Domain Number 1 Region: 25-87
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000847
Family Gar1-like SnoRNP 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I3XSJ3
Sequence length 111
Comment (tr|I3XSJ3|I3XSJ3_DESAM) RNA-binding protein involved in rRNA processing {ECO:0000313|EMBL:AFL66917.1} KW=Complete proteome OX=768672 OS=Desulfurococcus amylolyticus DSM 16532. GN=Desfe_1044 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MVYALYMNYEFKVDSDGNTRVILMNKLGMVETSTRDGFLIVKPSTRDVLKLVNSSVYDEN
NRRIGRIVDVIGRVDDPRVVVKLESKGLAPSSTVLYYYLASQRKHKRGGRR
Download sequence
Identical sequences I3XSJ3
WP_014767813.1.2099 gi|390938754|ref|YP_006402492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]