SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3XT19 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3XT19
Domain Number 1 Region: 17-143
Classification Level Classification E-value
Superfamily Prefoldin 0.00000000000432
Family Prefoldin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3XT19
Sequence length 156
Comment (tr|I3XT19|I3XT19_DESAM) Prefoldin alpha domain protein {ECO:0000313|EMBL:AFL67093.1} KW=Complete proteome OX=768672 OS=Desulfurococcus amylolyticus DSM 16532. GN=Desfe_1223 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MSSGSDTKEVKEAGRIQLEEILVRFNELREYANLLASTINTYLTQQRELQLALETLKNLP
EEGGEGYIILDRLSSAMIPAVINKEWSKGILVHLGLGYYLKADKAKALEIISKRSSNVER
VLGELQKRYSVVLEELNRLQQLLSRSYGGSQSKGGG
Download sequence
Identical sequences I3XT19
WP_014767988.1.2099 gi|390938930|ref|YP_006402668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]