SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3XTK3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3XTK3
Domain Number 1 Region: 9-258
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-67
Family G proteins 0.00000538
Further Details:      
 
Domain Number 2 Region: 468-628
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.14e-52
Family Translational machinery components 0.0000212
Further Details:      
 
Domain Number 3 Region: 260-383
Classification Level Classification E-value
Superfamily Translation proteins 3.14e-29
Family Elongation factors 0.001
Further Details:      
 
Domain Number 4 Region: 629-724
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 3.55e-21
Family EF-G/eEF-2 domains III and V 0.0055
Further Details:      
 
Domain Number 5 Region: 393-468
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.58e-19
Family EF-G/eEF-2 domains III and V 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3XTK3
Sequence length 736
Comment (tr|I3XTK3|I3XTK3_DESAM) Elongation factor 2 {ECO:0000256|HAMAP-Rule:MF_00054, ECO:0000256|SAAS:SAAS00384494} KW=Complete proteome OX=768672 OS=Desulfurococcus amylolyticus DSM 16532. GN=Desfe_1412 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MVKFKQTSEVLKIMGNIEQIRNIGITAHVDHGKTTLSDSLLSAAGLISEKIAGQALALDY
LDVEQKRQMTVKAANASLYHEYKGKPYLINLIDTPGHVDFQSKTIRALRVIDGAIVVVDA
VEGVMTQTEMYLRVALEERVRPVLFINKIDRLIKELRLSPTEIQQRLVQIVRDVNTLIAT
YADKEFQKAWLLDPMKGQVAFGSARDRWGLTIPLVQQKGIKFSDIVDVYTRGKEAVAELQ
KTAPLHEAILDMVVKHVPNPREAQRYRIPKIWHGDLNHEIVKYLIEADPNGPLVMLINDI
RVDPHAGLVATGRIYSGTLRPGEEVWLVNARVPQRVLQVSLYMGPYRELADEITAGNIAA
ALGLEKARSGETVVSMKYKDTMTPFEKLKMITESVVTVAIEPKNPQQTTKLIDALYKLHL
EDPSLIVKINEETGEYLLSGVGTLHIEIALTLLKDLYGLEVVTSPPVIVYRETIRDRSQV
FEGKSPNKHNKFYISVAPLNEETLRLLSEGIIMEDMDARERAKILREQAGWDADEARRIM
AIDENLNILIDMTTGVQYLREVKDTIIQGFRLAMREGPLAMEPVRGVKVVLHDAVIHEDP
AHRGPAQIFPAVRNAIFAGFLTARPTILEPILKLDIRSPMEYIGNISSVITKKRGKLIEV
QQMETTARVIAEIPVSESFDIADMLRNVTAGKAIWGQEFSRWAPVPENMLMDLIAKIRTR
KGLKPEPPKPEDFLSP
Download sequence
Identical sequences I3XTK3
WP_014768164.1.2099 gi|390939114|ref|YP_006402852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]