SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3XTK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3XTK5
Domain Number 1 Region: 8-113
Classification Level Classification E-value
Superfamily Prefoldin 4.58e-20
Family Prefoldin 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3XTK5
Sequence length 121
Comment (tr|I3XTK5|I3XTK5_DESAM) GimC subunit beta {ECO:0000256|HAMAP-Rule:MF_00307} KW=Complete proteome OX=768672 OS=Desulfurococcus amylolyticus DSM 16532. GN=Desfe_1414 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MSEKTLPPEVQQLLIQYQTLREHQARIDAELKMVEAELSDVENVMDTLKNVDDSAELYKV
VGHVIVKKSKADIVKELEERKELLVVKRDKYRKQLEFLNKQVNELEERIKEALSKHGLSI
E
Download sequence
Identical sequences I3XTK5
gi|390939116|ref|YP_006402854.1| WP_014768166.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]