SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3XTQ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3XTQ4
Domain Number 1 Region: 4-249
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.82e-77
Family G proteins 0.0000000741
Further Details:      
 
Domain Number 2 Region: 326-430
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 3.09e-40
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000265
Further Details:      
 
Domain Number 3 Region: 232-322
Classification Level Classification E-value
Superfamily Translation proteins 2.08e-28
Family Elongation factors 0.00000915
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I3XTQ4
Sequence length 438
Comment (tr|I3XTQ4|I3XTQ4_DESAM) Elongation factor Tu {ECO:0000256|HAMAP-Rule:MF_00118} KW=Complete proteome OX=768672 OS=Desulfurococcus amylolyticus DSM 16532. GN=Desfe_1463 OC=Desulfurococcaceae; Desulfurococcus.
Sequence
MSAPQKPHLNIVIIGHVDHGKSTMTGHILYRLGYFDEKSVKMIEEEAKKMGKESFKFAWL
LDRMKEERERGVTISLSYMKFETKKYFFTIIDAPGHRDFVKNMITGASQADAAILVVSAR
KGEFEAGMSAEGQTREHAILARTMGINQLIVAINKMDATEPPYSEKRYNEIKEILGKFLK
GLGYDISKIPFIPVSAWTGENLIERSPNMPWYNGPTLVEALDLLTVPPKPLDKPLRIPIQ
DVYSISGVGVVPVGRVETGVLKVGDKVVFMPPGLIGEVKSIETHHSKIEKAEPGDNIGFN
VKGIEKKDVKRGDVAGSLDVPPTVADEFTARIMIMWHPTAIAVGYTPVIHVHTASVACRI
TEIISKIDPRTGKEVEKNPQFLKQGDIAIVKFKPIKPLVVEKYADFPALGRFAMRDMGKT
IGIGQVLEIKPAQVNIKK
Download sequence
Identical sequences I3XTQ4
gi|390939165|ref|YP_006402903.1| WP_014768215.1.2099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]