SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I3ZYM6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I3ZYM6
Domain Number 1 Region: 34-244
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 4.36e-40
Family Endonuclease I 0.00063
Further Details:      
 
Domain Number 2 Region: 283-371
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000166
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I3ZYM6
Sequence length 457
Comment (tr|I3ZYM6|I3ZYM6_ORNRL) Endonuclease I {ECO:0000313|EMBL:AFL96810.1} KW=Complete proteome; Reference proteome OX=867902 OS=23171 / CIP 104009 / LMG 9086). GN=Ornrh_0609 OC=Flavobacteriaceae; Ornithobacterium.
Sequence
MKTMKYRNFLLLFLVSICTWAQVPDYYKSLDLTKTGEAFKKELSQLITQTHKRTLNYSEV
NGVLKVSDRDPQNPNNVLLIYGSENNNGKHARNRNKNNTGGGKDQWNKEHVYARALGNPN
LGSEGPGADAHHLRPADPPLNSDRGSLPFDDGRGAKAYKTNRGGWFPGDEWKGDVARMMM
YMAVRYGERCNPKRVGMAPYTFSKDFPDIFLKWNIEDPVSDFEKQRNEAIAKVQGNRNPF
IDNPNLATRIWGGPAAQDNWGNGIQTPVSPAPNQPEDTNDRGIQNLRASNVNPTNLTLTW
DLPENYRSVAYYDVFANDTFKQKAFTNTALITKLQPETSYTFKVVAKKSNGETTGESQTF
DFTTPAGFPDITNSTKTNKDLVFYPNPVTDSKLNVDGKNLQNIKWIKIYDLQGRLQKNIV
NPFIHERGGGYTIDISNLTKGIYILKTPSHQEKILVL
Download sequence
Identical sequences I3ZYM6
WP_014790431.1.65567 WP_014790431.1.68898 WP_014790431.1.95647 gi|392390001|ref|YP_006426604.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]