SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4EQB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4EQB2
Domain Number 1 Region: 8-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000457
Family GntR-like transcriptional regulators 0.018
Further Details:      
 
Domain Number 2 Region: 87-207
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.0000000000000497
Family GntR ligand-binding domain-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I4EQB2
Sequence length 215
Comment (tr|I4EQB2|I4EQB2_9ACTN) Transcriptional regulator, GntR family {ECO:0000313|EMBL:CCH85575.1} KW=Complete proteome; Reference proteome OX=477641 OS=Modestobacter marinus. GN=MODMU_0103 OC=Modestobacter.
Sequence
MSIAPVPRVLLRDHALTLIRSAIVSGELAPGAVVKDAELAGRLGLSVAPVRTALARLADE
GLVESKPQSHTRVTPLVPQQVRDAAVVVRAMHELAVREGAAAVTAADVAAMRAANERFAA
AVGAGDLDGALAADDELHDVLLARCGNTAVRATIDRFTPAVRRLERQRFAAAHGRGSVAL
HDSLIAACAAADVDAAVTTTTEIWTALLSELEETP
Download sequence
Identical sequences I4EQB2
gi|389861841|ref|YP_006364080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]