SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4EQL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4EQL3
Domain Number 1 Region: 102-212
Classification Level Classification E-value
Superfamily Sortase 0.00000000361
Family Sortase 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I4EQL3
Sequence length 214
Comment (tr|I4EQL3|I4EQL3_9ACTN) Peptidase C60 sortase A and B {ECO:0000313|EMBL:CCH85676.1} KW=Complete proteome; Reference proteome OX=477641 OS=Modestobacter marinus. GN=MODMU_0213 OC=Modestobacter.
Sequence
MRVPVAVLVAGLALAVGVPTAWAVTRPATAAGPPVASVLSTAPPAPVPAVAAPAVTARPA
APSAVVPVVPPVRLQLAGVDTPLDPVGVEPDGAMTLPEDVDRVGWYRFGPAPGDDEGTAV
LAGHVDDAEQGLGALAPLREAEVGDEVRVTDASGAVTGWRIVSRELIEKRAVPLDALFQR
TGPPRLVLLTCGGEFLPELRSYTDNVVVVAEPAP
Download sequence
Identical sequences I4EQL3
WP_014738292.1.28377 gi|389861941|ref|YP_006364181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]