SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4EWR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4EWR3
Domain Number 1 Region: 89-220
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 8.37e-27
Family GntR ligand-binding domain-like 0.0062
Further Details:      
 
Domain Number 2 Region: 21-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.78e-16
Family GntR-like transcriptional regulators 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I4EWR3
Sequence length 242
Comment (tr|I4EWR3|I4EWR3_9ACTN) Transcriptional regulator, GntR family {ECO:0000313|EMBL:CCH87826.1} KW=Complete proteome; Reference proteome OX=477641 OS=Modestobacter marinus. GN=MODMU_2397 OC=Modestobacter.
Sequence
MTEARAVREVSAGGDFGGELLSATVKRLVLDRIVGGHYRPGERIVEFKLAKELGLSQSPV
REALRELAAVGIVTIHPRRGARVRLPSAKELVDVSVVRSEVDALAARLAAGRIADDTLDA
LEGLVAEMLERLEAEDFPGVTEADVRFHQLIAEASENHALQRAFDQLAPFARTFITLTLP
GVDVRGIVAEHRPILDALRARDAERAATAAREHQLSVSELLQMHFPAALGDPATGQDGDT
DG
Download sequence
Identical sequences I4EWR3
WP_014740418.1.28377 gi|389864071|ref|YP_006366311.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]