SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4FVI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4FVI9
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-29
Family HD domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I4FVI9
Sequence length 198
Comment (tr|I4FVI9|I4FVI9_MICAE) Uncharacterized protein {ECO:0000313|EMBL:CCH99664.1} KW=Complete proteome OX=1160286 OS=Microcystis aeruginosa PCC 9717. GN=MICAB_6590012 OC=Microcystaceae; Microcystis.
Sequence
MRQQVIDWLKENVNEHRLRHILGVETMCIDLARHHDLDPVQAGQAGLLHDLAKFFKPKKL
LKMAESAGIDVDNICLSHPHLLHADVSAVVAQKEFNVTDEEILEAIRNHTLGKPNMSDLS
CIVFIADALEPNRGDTPELNALRQLSYQNLHKSVQQTCDYSLKYLLSSHCPIHPRTVLTR
NWALQIVKEQPTETKTID
Download sequence
Identical sequences A0A0K1RXJ7 B0JP68 I4FVI9
449447.MAE_05570 gi|166363298|ref|YP_001655571.1| WP_002763152.1.24258 WP_002763152.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]