SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4GQ80 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4GQ80
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Ribosomal protein S19 6.54e-36
Family Ribosomal protein S19 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I4GQ80
Sequence length 93
Comment (tr|I4GQ80|I4GQ80_MICAE) 30S ribosomal protein S19 {ECO:0000256|HAMAP-Rule:MF_00531} KW=Complete proteome OX=1160282 OS=Microcystis aeruginosa PCC 9806. GN=MICAE_100008 OC=Microcystaceae; Microcystis.
Sequence
MGRSLKKGPFVAGHLMEKIEKLNAQGSKQVIKTWSRASTIIPDMVGHTIAVHNGKQHVPV
YVSEQMVGHKLGEFAPTRTFRGHAKSDKKAGRK
Download sequence
Identical sequences A0A0A1VUR0 A0A0F6U0W1 A0A0K1RWL1 A0A139GJ42 A0A1V4BWT7 A0A2H6BMH7 A0A2H6L738 A8YFZ6 B0JHZ9 I4FA21 I4FXX3 I4G8T8 I4GJ72 I4GQ80 I4H7C4 I4HMX5 I4HWK4 I4I8T8 I4IMU3 S3JH26
WP_002753908.1.10452 WP_002753908.1.13945 WP_002753908.1.15998 WP_002753908.1.20667 WP_002753908.1.23084 WP_002753908.1.24258 WP_002753908.1.39664 WP_002753908.1.4043 WP_002753908.1.43950 WP_002753908.1.43975 WP_002753908.1.50331 WP_002753908.1.50673 WP_002753908.1.52201 WP_002753908.1.5315 WP_002753908.1.62741 WP_002753908.1.6707 WP_002753908.1.77316 WP_002753908.1.7764 WP_002753908.1.79847 WP_002753908.1.86711 WP_002753908.1.88161 WP_002753908.1.92877 WP_002753908.1.98808 gi|166368480|ref|YP_001660753.1| 449447.MAE_57390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]