SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4HNS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4HNS5
Domain Number 1 Region: 5-69
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 5.12e-16
Family 7-Fe ferredoxin 0.000073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I4HNS5
Sequence length 81
Comment (tr|I4HNS5|I4HNS5_MICAE) PsaC {ECO:0000256|HAMAP-Rule:MF_01303} KW=Complete proteome OX=1160285 OS=Microcystis aeruginosa PCC 9809. GN=MICAH_2450008 OC=Microcystaceae; Microcystis.
Sequence
MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCIGCKRCETACPT
DFLSIRVYLGAETTRSMGLAY
Download sequence
Identical sequences A0A0F6RND3 A0A139GQF4 A0A1V4BXA6 A0A2H6BVW0 A8YBC6 B0JJ37 I4FHG7 I4FXG1 I4GIH6 I4GZM0 I4H3Z2 I4HNS5 I4HPU9 I4IG48 I4IM90 L7EC03 L8NVS0 S3JVI8
gi|166368664|ref|YP_001660937.1| 449447.MAE_59230 WP_002734319.1.13945 WP_002734319.1.15998 WP_002734319.1.20667 WP_002734319.1.23084 WP_002734319.1.24258 WP_002734319.1.39664 WP_002734319.1.4043 WP_002734319.1.42333 WP_002734319.1.43950 WP_002734319.1.43975 WP_002734319.1.50331 WP_002734319.1.50673 WP_002734319.1.52201 WP_002734319.1.5315 WP_002734319.1.62741 WP_002734319.1.77316 WP_002734319.1.7764 WP_002734319.1.79847 WP_002734319.1.86711 WP_002734319.1.88161 WP_002734319.1.92877 WP_002734319.1.98808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]