SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4I3W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4I3W1
Domain Number 1 Region: 39-292
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.47e-82
Family Tryptophan biosynthesis enzymes 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I4I3W1
Sequence length 296
Comment (tr|I4I3W1|I4I3W1_MICAE) Indole-3-glycerol phosphate synthase {ECO:0000256|HAMAP-Rule:MF_00134, ECO:0000256|SAAS:SAAS00745756} KW=Complete proteome OX=1160285 OS=Microcystis aeruginosa PCC 9809. GN=MICAH_540005 OC=Microcystaceae; Microcystis.
Sequence
MQIRRKHPNPAVKVESLSYVVKVPEAQPQNILEEIVWHKEIEVDKLRERLPLLELRQKIA
NTAPPCDFLAALKQGKTQPALIAEVKKASPSKGVILEDFDPVAIARTYEQGGATCLSVLT
DSKFFQGSYENLTLVRQAVSLPLLCKEFILYPYQIYYARSKGADAVLLIAAILSDQDLAY
FVKIVKGLGMTALVEVHSLAEFDRVLAIEGIELIGINNRNLETFTVDLDNTRQLLEARGE
QVREKGILIVSESGLHTATDLAKVKQAGANAVLIGESLVKLPDPALGIQKLFENLG
Download sequence
Identical sequences B0JTM2 I4I3W1
449447.MAE_45030 gi|166367244|ref|YP_001659517.1| WP_004162667.1.4043 WP_004162667.1.50331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]