SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I4YJA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I4YJA0
Domain Number 1 Region: 18-56
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000445
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I4YJA0
Sequence length 102
Comment (tr|I4YJA0|I4YJA0_WALMC) PBD-domain-containing protein {ECO:0000313|EMBL:EIM24042.1} KW=Complete proteome; Reference proteome OX=671144 OS=(CBS 633.66)). GN=WALSEDRAFT_9879 OC=Wallemiomycetes; Wallemiales; Wallemiales incertae sedis; Wallemia.
Sequence
LSDLLQLQKKPEISTPYDPVHLTHVGFNSDTGEFTGLPKEWQQLLQDSGISKQDQEANPQ
AVMDIVAFYQDAQKAQLGAEDSQVWKKMGGVANGQPTGPVEK
Download sequence
Identical sequences I4YJA0
XP_006955640.1.58810 jgi|Walse1|9879|gw1.1.538.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]