SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I6L4Q1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6L4Q1
Domain Number 1 Region: 122-336
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.02e-46
Family Tyrosine-dependent oxidoreductases 0.0038
Further Details:      
 
Domain Number 2 Region: 12-49
Classification Level Classification E-value
Superfamily WW domain 0.000000000000195
Family WW domain 0.0011
Further Details:      
 
Domain Number 3 Region: 57-91
Classification Level Classification E-value
Superfamily WW domain 0.00000000016
Family WW domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I6L4Q1
Sequence length 353
Comment (tr|I6L4Q1|I6L4Q1_LATCH) WW domain containing oxidoreductase {ECO:0000313|Ensembl:ENSLACP00000017019} KW=Complete proteome; Reference proteome OX=7897 OS=Latimeria chalumnae (West Indian ocean coelacanth). GN=WWOX OC=Coelacanthiformes; Coelacanthidae; Latimeria.
Sequence
MAALKYAGLDDTDSEDELPPGWEERTTKDGWVYYANHVDQKTQWEHPKTGKRKRVAGDLP
YGWEQETDENGQLFFVDHINKRTTYLDPRLAFTVEDNPVKPNIRQRYDGNSTAMEILQGR
DLTGKVAIVTGANSGIGYETARSLALHGAHVILACRNRTRASVAVHQILDEWHKAKVEAM
TLDLAALHSVQQFSEAFKSKNLPLHLLICNAAVFAVPWQLTEDGLESTFQVNHLGHFYLV
QLLQDVLRHSAPSRVIVVSSESHRFTDIKGASEKLDLNLLSPSKREYWAMLAYNRSKLCN
ILFSRELHRRISPHGVMSNALHPGNMMYSSLHRNWWVYTLLFALARPFTKSMG
Download sequence
Identical sequences I6L4Q1
ENSLACP00000018037 ENSLACP00000017019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]