SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I6YM36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I6YM36
Domain Number 1 Region: 176-698
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 6.1e-162
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.0000000028
Further Details:      
 
Domain Number 2 Region: 24-173
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 1.02e-27
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I6YM36
Sequence length 709
Comment (tr|I6YM36|I6YM36_MYCWM) Ribonucleoside-diphosphate reductase {ECO:0000256|RuleBase:RU003410} KW=Complete proteome; Reference proteome OX=1197325 OS=Mycoplasma wenyonii (strain Massachusetts) (Eperythrozoon wenyonii). GN=WEN_02880 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence
MINKSQKITNPSYYNSLIFNNQVTLKGEDGFFCLEKDKLAIQEYQKYISECEKYSHKRRG
FERIKWLIETEYYLSQLIEKYSETQINQLTEEVYGAGFQWKSYISISKFFESFALRSNCG
KYILESYEDRVIVTSLFLADGDFELARKIANLIIKQIYQPATPTFSNAGKKRSGMLVSCF
LLEAEDSINSINYIISTSMQLSKIGGGVAINLSKLRGRGASIKQIDSTASGIFPVLKILE
NVFDYADQLGMRRGSGAVYLNIFHYDLIDFIDCKKINADEKSRIQTLSIGLIVPDKFLQL
ATENKNFFIFEPNTIYQKYRLSLPDLDFNYWYDILANDDSLLKKELSARAVLTKIAQIQF
ESGYPYVIFIDNANKKNPLKNIGKIKMSNLCTEIFQNQESSTIGDYGLGDIIRNDVSCNL
ASLNLVNVFEDGNLEEIADLSMRALSAVSDLTSITNAPSIRKANEEFKSVGLGVLNFTGL
LLKNGLEYDSPETLEIADVFFAALNYYSLLASSRIAQERKISFKEFENTDYFTGAYFEKY
ISHPYLPKSEKAKEIFKNMKLPTPEDWANLKELVKKNGIYNAYRLAVAPTQSISYLQGAT
ASIQPIISPIETRMYGSSITYFPMPFLNKDNHHLYKSAYLIDQKKLIDLSAIIQQHVDQG
ISTVLYVTNNSTTRDLVKLYLYAHHKGLKSLYYVRTKNLQPTECVSCQA
Download sequence
Identical sequences I6YM36
WP_014850068.1.71021 gi|397678152|ref|YP_006519688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]