SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7BW36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7BW36
Domain Number 1 Region: 157-220,249-349
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.000000384
Family NADH oxidase/flavin reductase 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I7BW36
Sequence length 350
Comment (tr|I7BW36|I7BW36_NATSJ) NADH oxidase {ECO:0000313|EMBL:AFO57115.1} KW=Complete proteome; Reference proteome OX=406552 OS=Natrinema sp. (strain J7-2). GN=NJ7G_1875 OC=Natrinema.
Sequence
MQFDWNGPADGGIRGTVFVDGTTNTYELDDIDVVEVLEYALTARSKDDLRTFACDSLECE
TTAADDLLDTLIETGFLLPDDHENFVAYRTWMDKGWQRALFYHLRTRTADVERPTPPDDR
EETARSGESLEPPSATARDGPRLDLPDPDELPDESFRAVALRRRTHRNFSGTEMDLTTLS
TVLHHAFGPVKAVFDHLEETPLAETEPGAIRRAGLRVYPVVQRCRDVPPGVYEYDIREHA
LVRIRTFDTVETADDAVTDAAHRQNHHTDAAVSLFFGSVFDHDQRWCPKSRGLRNSYLHV
SEHAHRLVLVATALRLRNFVTPALKDERIDALVGVEGDDEAITYLVAIGE
Download sequence
Identical sequences I7BW36
gi|397773645|ref|YP_006541191.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]