SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7G8D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7G8D4
Domain Number 1 Region: 36-219,286-362
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.98e-66
Family Crotonase-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I7G8D4
Sequence length 386
Comment (tr|I7G8D4|I7G8D4_MACFA) 3-hydroxyisobutyryl-coenzyme A hydrolase {ECO:0000256|RuleBase:RU363052} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MGQREVWRLMSRFNAFKRTNTILHHLRMSKHTDAAEDVLLEKKGCAGVITLNRPKFLNAL
TLNMIRQIYSQLKKWEQDPETFLIIIKGAGGKAFCAGGDIRVISEAEKAKQNIAPVFFRE
EYMLNNAVGSCQKPYVALIHGITMGGGVGLSVHGQFRVATEKCLFAMPETAIGLFPDVGG
GYFLPRLQGKLGYFLALTGFRLKGRDVYRAGIATHFVDSEKLAMLEEDLLALKSPSKENI
ASVLENYHTESKIDRDKSFMLEEHMDKINSCFSANTMEEIIENLKQDGSSFALEQLKVIN
KMSPTSLKITLRQLMEGSSKTLQEVLTMEYRLSQACMRGHDFHEGVRAVLIDKDQSPKWK
PADLKEVTDEDLNNHFKSLGSNDLKF
Download sequence
Identical sequences A0A1D5RL20 I7G8D4
9544.ENSMMUP00000009546 NP_001272281.1.63531 XP_014966037.1.72884 ENSMMUP00000009546 ENSMMUP00000009552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]