SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7GJL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7GJL7
Domain Number 1 Region: 26-188
Classification Level Classification E-value
Superfamily RUN domain-like 3.92e-45
Family RUN domain 0.0000517
Further Details:      
 
Weak hits

Sequence:  I7GJL7
Domain Number - Region: 245-313
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0798
Family Myosin rod fragments 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I7GJL7
Sequence length 400
Comment (tr|I7GJL7|I7GJL7_MACFA) Macaca fascicularis brain cDNA clone: QbsB-10421, similar to human RaP2 interacting protein 8 (RPIP8), mRNA, RefSeq: NM_006695.3 {ECO:0000313|EMBL:BAE87206.1} OX=9541 OS=Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey). GN= OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVN
FAAILEQILSHRFKGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKG
RAWIRVALMEKRMSEYITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAIDFSFC
LKGEVLDGKTPVVIDYTPYLKFTQSYDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDED
SWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLKDLEAENRRLQLQLEEAAAQNQREKR
ELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTLNGAEGASNSKLYRRH
SFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGSSEPN
Download sequence
Identical sequences A0A2J8J4H9 F6RZ73 I7GJL7
NP_001138298.1.87134 NP_001138298.1.92137 XP_008010620.1.81039 XP_011717972.1.29376 XP_011841301.1.47321 XP_011914130.1.92194 XP_014975349.1.72884 XP_016787150.1.37143 O15483 ENSP00000468214 gi|221307580|ref|NP_001138298.1| ENSP00000468214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]