SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7KAX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7KAX2
Domain Number 1 Region: 419-543
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.05e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.082
Further Details:      
 
Domain Number 2 Region: 281-418
Classification Level Classification E-value
Superfamily GAF domain-like 8.07e-21
Family GAF domain 0.0053
Further Details:      
 
Domain Number 3 Region: 144-253
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.13e-19
Family PYP-like 0.088
Further Details:      
 
Domain Number 4 Region: 5-116
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000907
Family Heme-binding PAS domain 0.054
Further Details:      
 
Weak hits

Sequence:  I7KAX2
Domain Number - Region: 551-610
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00334
Family Homodimeric domain of signal transducing histidine kinase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) I7KAX2
Sequence length 630
Comment (tr|I7KAX2|I7KAX2_METBM) Putative PAS/PAC sensor protein {ECO:0000313|EMBL:CCJ35071.1} KW=Complete proteome; Reference proteome OX=1201294 OS=MS2) (Methanogenium bourgense). GN=BN140_0148 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MYHCFEELDDAVVILDRDNNVARLNGSFQETFGIGDDAAQGMEIGNLIARHLAPLFEEGD
SVGRIIETLRCRREVSHVTCRMQPSHGGMRWFSFSCRVMTGEPYAGMMLIRFRDVTPERD
EAARSVLDTATQVRPESIYAGIGEMLPYGIWICEPDGTALYISASFLNLAGTTLEECRRT
GLMDCIPLKDAAGVLDDWKRCLNTGCRWDRELVVADPDRGHRTILSRGAPVRDENDQIIL
WAGINLDVTARKHAEDLTAVRAAQQAAIAALGQFALAGAELPELMNAVVRMVAECLGVEY
AKVLRYLPNEYLFILEAAVGFGGVRVGTEKVDGGTDSQAGYTLLSHEPVIVEDFDAETRF
RGPALLRDEGILSGISVIIQGDEAPYGVLGAHTRTLRRFTRDDINFVQAAANVLALGFKR
KAAEEALSKSEEKFREIAQRSFDMIYTCYHDRGITYMSPAVTRILGFTPAELIGCKCRDY
VTPVSLAAWEGGQKKMARGESIEGLEVEFRRKDGTTAFVELNESPIVENGKVVGVQAVGR
DITERKQTEQLNQQAFEQIERNIEQFAVLGDHIRQPLQVILGMADLADDPKTSAVIHDQV
ERINEYIRQLDRGWVESREVRAFLRRHDRE
Download sequence
Identical sequences I7KAX2
WP_014866048.1.51038 gi|397779314|ref|YP_006543787.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]