SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7KDL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7KDL3
Domain Number 1 Region: 639-759
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.77e-30
Family Heme-binding PAS domain 0.013
Further Details:      
 
Domain Number 2 Region: 758-884
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.43e-25
Family Heme-binding PAS domain 0.074
Further Details:      
 
Domain Number 3 Region: 43-150
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.16e-24
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.084
Further Details:      
 
Domain Number 4 Region: 515-640
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000223
Family PYP-like 0.088
Further Details:      
 
Domain Number 5 Region: 298-391
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000808
Family Heme-binding PAS domain 0.044
Further Details:      
 
Weak hits

Sequence:  I7KDL3
Domain Number - Region: 214-264
Classification Level Classification E-value
Superfamily GAF domain-like 0.00632
Family GAF domain 0.017
Further Details:      
 
Domain Number - Region: 468-527
Classification Level Classification E-value
Superfamily GAF domain-like 0.0192
Family GAF domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I7KDL3
Sequence length 971
Comment (tr|I7KDL3|I7KDL3_METBM) Putative PAS/PAC sensor protein {ECO:0000313|EMBL:CCJ36986.1} KW=Complete proteome; Reference proteome OX=1201294 OS=MS2) (Methanogenium bourgense). GN=BN140_2063 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MPDFYDPRSRLPSLQDQTRMPTPDFSTTPLGDESGVPAELADETVPYGIWICGPDGGVLY
LSDSYLDLAGMTLEECRGTGWASNIHPEERAAALAAWEHTVATGETWSRDYRILGSDGEY
HTIASRGVPIRDVAGQVILWAGINLDITGRERLQGLVKEFRTLYAISRLIGEGDAGVEEV
FRRTADLLPGGFQNPGRVSIRVVPGTAAPGGGRITVPIIAGRRTVGHLVVETDNPVRQQE
RDLVAAAAAMLGAAVGQAEANAATTASERQYRLLFDQMLDVGLLLEVIRGGSGEPAGFRV
IQINRKAEEALGRRRDEVAGEDLVTAVPSVGPVTLDLCRGVARTGTPVHREVYSPDVDAY
YELRAYRPEYDRLVVIINDITDRRRAEEKLRMQRSDLDNRVRELATLYAMTGIVERPGIT
LDAILQEVATVLPAGWLHPEDAVARITLDDREYLSAGFCETSWRQESPIIVHGRTAGRVE
VCYLHEHPRADEGSFLTEERSLIDTVAERLGRTIERMRADEGLRRSEEKYRLLFEQMLES
YTLYEVVRDNEGSPVDYRLLELNEKAADLFGRSREELVGRRLFDVFPAIREGAGALYGEV
AETGVPVQRRLQEPGSGRWYELHIYQPQPGRLAVIGQDITEQKKAERALRESEERFRGIF
EQAGAGIALIDPGGRITETNPAFVRMFGYDEDELHAMLFPDLIFSPDRENAGALPRESVQ
REMRYVTKDGRTIWGRLTTSLLHDPGERGFVIGMVEDITDWREMQNALRESEERFREIAQ
RSFDMIYTCYADRGITYISPAVMRILGYTPEEMIGVQCRDYVLDESWSAWLEARIRVARG
EPVEGLLVELRRKDGTAAFVEMNESPIIENGEVVGVQVVGRDVSDRKRYEDLRLQAFYQI
EQNIEQFAILADHIRLPLQVILGTADLIDDGGASAKIRRQVDRINGIVKQLDEGWVESRK
IREFLRRNELV
Download sequence
Identical sequences I7KDL3
WP_014867959.1.51038 gi|397781229|ref|YP_006545702.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]