SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7KE66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7KE66
Domain Number 1 Region: 365-490
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.76e-18
Family Heme-binding PAS domain 0.04
Further Details:      
 
Domain Number 2 Region: 505-619
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.31e-16
Family Flavin-binding PAS domain 0.032
Further Details:      
 
Domain Number 3 Region: 80-183
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000128
Family Heme-binding PAS domain 0.058
Further Details:      
 
Domain Number 4 Region: 10-67
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000506
Family PF1790-like 0.074
Further Details:      
 
Domain Number 5 Region: 190-380
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000564
Family GAF domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I7KE66
Sequence length 630
Comment (tr|I7KE66|I7KE66_METBM) Putative PAS/PAC sensor protein {ECO:0000313|EMBL:CCJ37511.1} KW=Complete proteome; Reference proteome OX=1201294 OS=MS2) (Methanogenium bourgense). GN=BN140_2588 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MSPGQEITGRILRTLRFRSKGMTITEIARALGMNRNSVSKHLEVMQVAGQVESRLVGNAK
VYSVAQRVPLSAFLCFTQNPILILDANLTIIQANDQLLRHFGRTKEDLLGQNIRDTALPA
VSTQEALAVIEGLEREQVITDVCCRNDSGRESFYQMQVIPTTFEDGEKGCTIVFEDITER
KRYIQNTMFLARTAMDLVDLPPVGDIYQYIVDRLTELVPGARIYLFAHDEVDRQFVVRAV
AGEGFREGLTELLGRDPVGLVLPVARAFDAPYHQTPHVMRGMQEFALRPEPSSWPFYDLC
FRAIPEGVCEAILSRYNIGTLWAAGLVWREQLFGIVGIFLEQGKDLENQETVESFIRQVS
IALARRQIEGRLRRNEERFRGMVDSSPFAVALINQEGRFVYVNRKFVEVFGYGPEDAPTC
SEWFRLVFPDAGYRQEAVKAWRLDLERSVTGQVRPRAFTVRCRDGSRKVILFRAVTLPDG
TQYLTCEDITEEARTYRLLLADIADLRHREQEMLLKDRAIASTGRAVALLDPDGVVTYAN
QAYLALWGYRTAADVQGSHFSRFWEPPDGAREVVRAALEGEVWHGELTGIRSGGETFRVD
LLGTPIIGRDGRVLGMMAAVTAGRVKDERS
Download sequence
Identical sequences I7KE66
gi|397781754|ref|YP_006546227.1| WP_014868482.1.51038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]