SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7LK61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7LK61
Domain Number 1 Region: 187-434
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 6.8e-119
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000194
Further Details:      
 
Domain Number 2 Region: 3-186
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.37e-74
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I7LK61
Sequence length 434
Comment (tr|I7LK61|I7LK61_METBM) Coenzyme-B sulfoethylthiotransferase beta {ECO:0000256|PIRNR:PIRNR000263} KW=Complete proteome; Reference proteome OX=1201294 OS=MS2) (Methanogenium bourgense). GN=BN140_1734 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MAKFKDTIDLYDDAGKLLKSGVPLDKISPLVNPATRKIIDLTKRTIAVNLGGIQDALKTG
KVGKGHVLGREMDLDIVGNKDAVIGKIKEMVQVQEGDDTKIREFSGGKLFLVEVPSARLE
AASTYDAAITSVAAATTYAIVEQFDVGPFDAAMVKGAVWGAYPHTMDMKGALVTSILNIP
QNNEGLGYALRNIPVNHVVMMTNKNAMEGAALASTFEQAGMFEMGNAIGPFERAQLLTYA
YQGLNANNLVYDLVKKNGSTGTIGTVVQSLVERAIEDKVITPGKKGGYFQFYDTKDPMLW
NAYAAAGTMAATMVNCGAGRFAQAVSSTLLYFNDLLEHETGLPGCDYGRVMGTAVGFSFF
SHSIYGGGGPGIFNGNHVVTRHAAGVAIPCVVAAAALDAGTQMFSPESTSKIYADTYGKV
DVFNKPIQQIAQGV
Download sequence
Identical sequences A0A0X3BPK7 I7LK61
gi|397780900|ref|YP_006545373.1| WP_014867631.1.51038 WP_014867631.1.63524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]