SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7LKK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7LKK5
Domain Number 1 Region: 1133-1429
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 8.48e-24
Family Complement components 0.041
Further Details:      
 
Domain Number 2 Region: 1891-1946
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000017
Family Type I dockerin domain 0.0028
Further Details:      
 
Domain Number 3 Region: 32-138
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000000489
Family Cellulose-binding domain family III 0.014
Further Details:      
 
Weak hits

Sequence:  I7LKK5
Domain Number - Region: 749-838
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0366
Family Cellulose-binding domain family III 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) I7LKK5
Sequence length 1956
Comment (tr|I7LKK5|I7LKK5_METBM) Uncharacterized protein {ECO:0000313|EMBL:CCJ37067.1} KW=Complete proteome; Reference proteome OX=1201294 OS=MS2) (Methanogenium bourgense). GN=BN140_2144 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MKKYLLTLLLFALCMLVTAAGAAWIEAPGSYPKVVVPAGSTGVFPVSVGGLTNAEGVYFN
LTFDNTLLSVESVSANDAIPGSRVTANINNESGWMQVAVTNTEGITVEERTPLVDITFRS
TGIEGESPLQFVGTMGYNSTYSQGFELEEFYGAYSGTIRVVESPSTIRAPSGTLASGQSK
TLAVGVDNLTGAKQIWFELMYDGSYLIIDDIQPALLGAVITGAFANNGIHEFEPTALESV
PEEVRLELQQHPHMNMMWVELEIPGGLTTTGYTDVVDITFRPTNRTGTGDLDFYYRCTYQ
DENESTQLFDIQIPGQIVTNGGGKYPVLGEFQAPSGTIDVGSQKVLPLMVRSLDNAEGAY
VWAGWNSAIINVTSVSLNATAQAAGVTLEGSGIHSDVYDNISTGRLYAYVENLTKLNTAS
WTPLLDLTVRANANSGRTPVDIWGTAYIIPRENVSIVYPPASLENGQISITVPEKADLRG
NLVPWPDYVKKYADGSLHFTQTMVIENTGNKAVTEDFDIRGTFCSKEAEFPVSGGIAPGE
NITYHVTMHVKPDHEGGTRISMIGGQEHERRYDVTTRGDVQTGNHTIALQIDVNDVIDEI
DKDNNYVEADVVVTYPDLVPVWKMEYVGGPSSSNTTILDTSHAPGTWKITFGAENIGKVF
ADPTTLNFTVGEGAPTVYTVPKLEPGENWTETISVDVGRVFTTYSVEVNANRAEAEEDYD
NNSLTESIGSTAVTVVFPPVYGSSDDDDDTKVEIWITNISRTAPVTEFKLPVKYDPTICY
YNGTFDVLGGVDVESSYGRVTLSGKNLELRGDTLIATLKMRARTDSGRTSVLNSSKSAYV
KTGNAYLDLEIIHGTFEQRSTTNASVAVFAPRSGPAGQNQAISVTIQNLKSNNVTVSANL
TATNETASETLWEMSDIYLTGRASKTFTIDTWQPVGGAYTLNATITGDNVTGNNIASRPI
VIDSYELNVTEQNKRYWNAWYGYDRSVLRDEHLWLGTYFTANQSGMVDATLAITYPNGTP
DGESAFEFHHYYPAQNPVYAYDSEWNSVAWYYVTPRQLGDFNYSITLKARGESAYVNGTI
KVREPNVDIKVMNTTLVTDESSKTMTFPVFNRTPSEGRNVQILLSAGADGRTLQGLESLI
GYPHGCPEQVMSPALAALRVKQYYEQRGALNDDINKTVRTAMQNALGHMNATGYNAQQAS
GGWAWGTWSTPSMFYTFYPNYVITELLMDNDPAFWDVDASMNGIDLDASANWLIQKQKRE
GVANGSWSDWGYISNDVEWTGFISENLKNEYPYLNKTMKIEVNASLDRSCNWLLTHNYTN
EDTQALSYAILGLVAIRDHGGIGDAEAINETVDDLKGELLKKRDRVGSYWEDSYGWNTYE
PTASAILALNKAGISADELSGGISHLIGNRAGRSYSGGWGSTRTSAAVINTLTNVVPQKP
VAFTVDAEIVRGDGTSVWSCMGIEFNETSFGFERTLSIDELNILYGSSVPDDTAKVIISN
KNDAASDNPGKLSVSIDSFEQVPESLAVATIPDIYIDPIATDFNLQIVAPDPGTLKEGEF
RDVGFTINNNLVEPRDQGVMIIEIPISNAVNFTGNATGADAAFYNDGTGRKNISHMYNAT
EKKLYIYPGSDNESAPSVLAGEIKTFFVPLTFGASGNITVEARAYPMYNDTWMALGNSST
YVLGYGNVTLAAVDETTNGPVEAGFYVNGLSVGSGTSYTDRLLEGKYSVAIWRDPVWINS
TVNVAPSESVTYTAHFARDRSVPYIAQAEGTAGEIQVMPPAIEDTISDDSPNHWNAATKA
MKSFNASISSSGGRATLAVDIPKVSRTAVNDTGTYEFSVYLNDNPVSVSMYDGENWSSYE
YRPRGERLTISDIDTSKIKQISITFTGREYGDVDNDKVIDVADAFMIVKARYNQVSFTEN
QWFYADVDNDGIVDVADAFLLVKWRFDQVDHDYQPK
Download sequence
Identical sequences I7LKK5
gi|397781310|ref|YP_006545783.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]