SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for I7LN94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  I7LN94
Domain Number 1 Region: 485-619
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.14e-28
Family Histidine kinase 0.001
Further Details:      
 
Domain Number 2 Region: 263-408
Classification Level Classification E-value
Superfamily GAF domain-like 5.89e-22
Family GAF domain 0.014
Further Details:      
 
Domain Number 3 Region: 119-224
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.8e-16
Family Heme-binding PAS domain 0.084
Further Details:      
 
Domain Number 4 Region: 3-129
Classification Level Classification E-value
Superfamily CheY-like 5.27e-16
Family CheY-related 0.0049
Further Details:      
 
Weak hits

Sequence:  I7LN94
Domain Number - Region: 397-472
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000432
Family Homodimeric domain of signal transducing histidine kinase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) I7LN94
Sequence length 628
Comment (tr|I7LN94|I7LN94_METBM) Multi-sensor signal transduction histidine kinase {ECO:0000313|EMBL:CCJ36929.1} KW=Complete proteome; Reference proteome OX=1201294 OS=MS2) (Methanogenium bourgense). GN=BN140_2006 OC=Methanomicrobiaceae; Methanoculleus.
Sequence
MSDPLRLLVITQSPGDARMIREVLREAGLPSEVVWRSRSRDALDALQGEPFDLLLLDPDP
EVVAQAGERAPGTPIVLLVSRDDMETAVRALGRGADDHLVREDITPELLVCTVRHALTLK
RMKTALERMGGMWREIVGNLHEGVMVADREGTTLFASARMAEILGYAAEEMLKAPFLSFV
DPEDAPRAEALLGTAGRAEAEFRLRRFDGERVGVRLIVFPVTCGTAVGVMDIRERPAEEE
IRRRNVQLSIINQVVRTATSSADMDELLTGVLGKTVNLLGFGGGSVYLIDSGRSRAELAA
EIGLPEGFSFRQRIADMNAPPYDTVLGQGVPHFVEDYPRRYPQDAGAGIQAFASIPITAE
GRVIGAVNLVSREMHTFSPAERELLTSIGQEIGSAVERMRLRKRLEKAHEEANFYLDVMT
HDINNANTTAIGYAALLSEALSGPEKDLARRISAAVRQSAEIIGNVSTIRRIAEETPAPG
PVSLDDVIGHVSCFFADADIRYAPQGLWVAADDLLSAVFINLLGNAVKFGGPQIVIQVTA
REEDGTVTVSVEDTGPGIPDAEKPLVFEKFRKSGARSGKGIGLYIVHTLVERYGGRVWVE
DRVPGRPREGAAFRFTLPACPPVTGRTG
Download sequence
Identical sequences I7LN94
WP_014867902.1.51038 gi|397781172|ref|YP_006545645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]