SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J1RBD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J1RBD9
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-18
Family BPHL domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J1RBD9
Sequence length 122
Comment (tr|J1RBD9|J1RBD9_9NOCA) Uncharacterized protein {ECO:0000313|EMBL:EJJ01579.1} KW=Complete proteome OX=745408 OS=Rhodococcus sp. JVH1. GN=JVH1_0854 OC=Rhodococcus.
Sequence
MQTLQPIFDKREQLAQIQSGLLQGESVIAVYDCIGTGTGFVALTDRRVILQDRSFVGNKT
AITSIPYGKIRSVSVVSNKSWAGAFFSGGSIAIDAGKVHTAEFRGMDKSRHVHDVILWHI
TR
Download sequence
Identical sequences J1RBD9 Q0SJF3
gi|111017519|ref|YP_700491.1| WP_009473107.1.53434 WP_009473107.1.60566 WP_009473107.1.78234 101510.RHA1_ro00497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]