SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3B442 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3B442
Domain Number 1 Region: 9-199
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000000000655
Family Ccg1/TafII250-interacting factor B (Cib) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J3B442
Sequence length 230
Comment (tr|J3B442|J3B442_9BACL) Uncharacterized protein {ECO:0000313|EMBL:EJL43866.1} KW=Complete proteome OX=1144311 OS=Brevibacillus sp. CF112. GN=PMI08_02414 OC=Brevibacillus.
Sequence
MIQTIADSVAGPDGQSIPYTLIQAGESPSRALCFFFPGASYSFDKPYLYYSTMLFLRKQV
DIVHVHYSFGQDNAAFWNSPFAEKSAWLQADAKRLVSHVLGKRAYEQIFFLGKSIGTIPI
ACGLLHASAFSRTSAVLLTPLLTEESLVADLLSVKQQVLLVSGTQDPYYQPTALEKIASS
RPNVRLYLPDGAKHSLDVGLDVSRSLAVLQSVMDELDSFVERELDAHAGS
Download sequence
Identical sequences J3B442 L5N0F2
WP_005826529.1.102010 WP_005826529.1.21232 WP_005826529.1.2485 WP_005826529.1.94307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]