SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3KA90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.


Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J3KA90
Sequence length 114
Comment (tr|J3KA90|J3KA90_COCIM) Uncharacterized protein {ECO:0000313|EMBL:EAS31914.3} KW=Complete proteome; Reference proteome OX=246410 OS=Coccidioides immitis (strain RS) (Valley fever fungus). GN=CIMG_13148 OC=Eurotiomycetidae; Onygenales; Onygenales incertae sedis; Coccidioides.
Sequence
MNLNTVIDSPNSDAVPTVFTEAQNSQDSLIQPVSRTTSAPIKNSKIQNEYSPASPSKIQK
EGPPTLPHEIQQEINSIANYSDTSMDLDTVIDSSNPDTIPTAFTEVQNPQDSLI
Download sequence
Identical sequences J3KA90
CIMG_13148T0 XP_001243497.2.59393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]