SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3KNV4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3KNV4
Domain Number 1 Region: 34-473
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.14e-78
Family Integrin alpha N-terminal domain 0.00000128
Further Details:      
 
Domain Number 2 Region: 797-1035
Classification Level Classification E-value
Superfamily Integrin domains 1.1e-49
Family Integrin domains 0.00086
Further Details:      
 
Domain Number 3 Region: 473-633
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-30
Family Integrin domains 0.0047
Further Details:      
 
Domain Number 4 Region: 634-786
Classification Level Classification E-value
Superfamily Integrin domains 7.59e-23
Family Integrin domains 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J3KNV4
Sequence length 1131
Comment (tr|J3KNV4|J3KNV4_HUMAN) Integrin alpha-7 {ECO:0000313|Ensembl:ENSP00000343009} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ITGA7 OC=Catarrhini; Hominidae; Homo.
Sequence
MAGARSRDPWGASGICYLFGSLLVELLFSRAVAFNLDVMGALRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDQGADMQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDMIGRCFVLSQDLAIRDELDGGE
WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGLLFVTNIDSSDPDQLV
YKTLDPADRLPGPAGDLALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKD
SASRLVPEVMLSGERLTSGFGYSLAVADLNSDGWPDLIVGAPYFFERQEELGGAVYVYLN
QGGHWAGISPLRLCGSPDSMFGISLAVLGDLNQDGFPDIAVGAPFDGDGKVFIYHGSSLG
VVAKPSQVLEGEAVGIKSFGYSLSGSLDMDGNQYPDLLVGSLADTAVLFRARPILHVSHE
VSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVDADTDRRLRGQVPRVTFL
SRNLEEPKHQASGTVWLKHQHDRVCGDAMFQLQENVKDKLRAIVVTLSYSLQTPRLRRQA
PGQGLPPVAPILNAHQPSTQRAEIHFLKQGCGEDKICQSNLQLVRARFCTRVSDTEFQPL
PMDVDGTTALFALSGQPVIGLELMVTNLPSDPAQPQADGDDAHEAQLLVMLPDSLHYSGV
RALDPAEKPLCLSNENASHVECELGNPMKRGAQVTFYLILSTSGISIETTELEVELLLAT
ISEQELHPVSARARVFIELPLSIAGMAIPQQLFFSGVVRGERAMQSERDVGSKVKYEVTV
SNQGQSLRTLGSAFLNIMWPHEIANGKWLLYPMQVELEGGQGPGQKGLCSPRPNILHLDV
DSRDRRRRELEPPEQQEPGERQEPSMSWWPVSSAEKKKNITLDCARGTANCVVFSCPLYS
FDRAAVLHVWGRLWNSTFLEEYSAVKSLEVIVRANITVKSSIKNLMLRDASTVIPVMVYL
DPMAVVAEGVPWWVILLAVLAGLLVLALLVLLLWKMGFFKRAKHPEATVPQYHAVKIPRE
DRQQFKEEKTGTILRNNWGSPRREGPDAHPILAADGHPELGPDGHPGPGTA
Download sequence
Identical sequences J3KNV4
XP_005268899.1.92137 ENSP00000343009 ENSP00000343009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]