SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3QKZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3QKZ8
Domain Number 1 Region: 8-147
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.06e-37
Family N-terminal domain of adrenodoxin reductase-like 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J3QKZ8
Sequence length 164
Comment (tr|J3QKZ8|J3QKZ8_HUMAN) NADPH:adrenodoxin oxidoreductase, mitochondrial {ECO:0000313|Ensembl:ENSP00000463308} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FDXR OC=Catarrhini; Hominidae; Homo.
Sequence
MEDKDREQHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNV
EVGRDVTVPELQEAYHAVVLSYGAEDHRALEIPGEELPGVCSARAFVGWYNGLPENQELE
PDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKAALGVL
Download sequence
Identical sequences J3QKZ8
ENSP00000463308

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]