SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3QLP1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3QLP1
Domain Number 1 Region: 4-125
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.74e-46
Family Acetylcholinesterase-like 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J3QLP1
Sequence length 125
Comment (tr|J3QLP1|J3QLP1_HUMAN) Cocaine esterase {ECO:0000313|Ensembl:ENSP00000463641} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CES2 OC=Catarrhini; Hominidae; Homo.
Sequence
MCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVF
GMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQVAALRWVQQNIA
HFGGN
Download sequence
Identical sequences J3QLP1
ENSP00000463641 ENSP00000463641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]