SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3QNG1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3QNG1
Domain Number 1 Region: 70-186
Classification Level Classification E-value
Superfamily Ras GEF 2.35e-17
Family Ras GEF 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J3QNG1
Sequence length 320
Comment (tr|J3QNG1|J3QNG1_MOUSE) Predicted gene 6408 {ECO:0000313|Ensembl:ENSMUSP00000136735} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Gm6408 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MFSCFQGSRGSGHKKAKSGFLVRFWRRLIRPLTHFRHASHSEPKVCSQNEQEPDCMPRRP
RFNYNSPEYVVQMIHYIPAAVQHNDHVCIRIFLAMYPSYASTWKVLDLLMTTYAFFLPDR
IKDQETKRAIFRFLFHWFKKFPKDFYESPDLAVVRQFIDYVRHNVPSADEDTQARELLSV
LEEQEAIGLNPEEDFATAPEPSEQDASGRQETLAPRPASETEPQGDKQPREDPELVKGAV
LDPSEPKATIELPPSLHQAVPTSDGTLSPVDVTADEATGVAADEAADVAADVSPARQLFV
SYTVQLGTPDFVIPLPEVDI
Download sequence
Identical sequences J3QNG1
ENSMUSP00000136735 PGOMOU00000127457 NP_001230033.1.92730 ENSMUSP00000136735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]