SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for J3QP84 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3QP84
Domain Number 1 Region: 47-266
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-35
Family Voltage-gated potassium channels 0.0024
Further Details:      
 
Domain Number 2 Region: 282-405
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000394
Family Potassium channel NAD-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J3QP84
Sequence length 1059
Comment (tr|J3QP84|J3QP84_MOUSE) Calcium-activated potassium channel subunit alpha-1 {ECO:0000313|Ensembl:ENSMUSP00000137141} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Kcnma1 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
QEAQKINNGSSQADGTLKPVDEKEEVVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVF
ALSIGALVIYFIDSSNPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLWFWLE
VNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLVNLLS
IFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAKTTLG
RLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESVSNFL
KDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESAD
ACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKIEEDTWQKYYLEGV
SNEMYTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRILINPGNHLKIQEG
TLGFFIASDAKEVKRAFFYCKACHDDVTDPKRIKKCGCRRPKMSIYKRMRRACCFDCGRS
ERDCSCMSGRVRGNVDTLERTFPLSSVSVNDCSTSFRAFEDEQPPTLSPKKKQRNGGMRN
SPNTSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSEAAMTV
LSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWETLHNFP
KVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKSMQFDD
SIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELVNDTNVQFLDQD
DDDDPDTELYLTQPFACGTAFAVSVLDSLMSATYFNDNILTLIRTLVTGGATPELEALIA
EENALRGGYSTPQTLANRDRCRVAQLALLDGPFADLGDGGCYGDLFCKALKTYNMLCFGI
YRLRDAHLSTPSQCTKRYVITNPPYEFELVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQ
SSSKKSSSVHSIPSTANRPNRPKSRESRDKQKRRELVLR
Download sequence
Identical sequences J3QP84
ENSMUSP00000137141

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]