SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3QPC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  J3QPC1
Domain Number - Region: 39-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00641
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J3QPC1
Sequence length 141
Comment (tr|J3QPC1|J3QPC1_MOUSE) Somatomedin B domain-containing 1 {ECO:0000313|Ensembl:ENSMUSP00000137187} KW=Complete proteome; Reference proteome OX=10090 OS=Mus musculus (Mouse). GN=Gm933 OC=Muroidea; Muridae; Murinae; Mus; Mus.
Sequence
MWFAFLLLLWLGPVIPNQKAGSCSQPQPLCCPGEDYGCKRGNCYCDKFCRVLSDCCPDHE
TLCNSSDLHAGSLPPVAQLDAVTHRAFHTPKMVLQMVLRTERPLDSARNNQDLVQNMVLQ
LLHSLSRRPLSVTMKGIRKRA
Download sequence
Identical sequences J3QPC1
ENSMUSP00000137187 NP_001243238.1.92730 ENSMUSP00000137187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]