SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J3QSC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J3QSC0
Domain Number 1 Region: 3-201
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.3e-34
Family Acetylcholinesterase-like 0.0000579
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J3QSC0
Sequence length 201
Comment (tr|J3QSC0|J3QSC0_HUMAN) Cocaine esterase {ECO:0000313|Ensembl:ENSP00000464620} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=CES2 OC=Catarrhini; Hominidae; Homo.
Sequence
XVDSEALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGV
NNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQ
TLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHVKFT
EEEEQLSRKMMKYWANFARNG
Download sequence
Identical sequences J3QSC0
ENSP00000464620 ENSP00000464620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]