SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J4HVX1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J4HVX1
Domain Number 1 Region: 453-498,535-573
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000827
Family UBX domain 0.05
Further Details:      
 
Domain Number 2 Region: 229-317
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000268
Family Thioltransferase 0.043
Further Details:      
 
Weak hits

Sequence:  J4HVX1
Domain Number - Region: 7-50
Classification Level Classification E-value
Superfamily UBA-like 0.000684
Family TAP-C domain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J4HVX1
Sequence length 604
Comment (tr|J4HVX1|J4HVX1_9APHY) Uncharacterized protein {ECO:0000313|EMBL:CCM01252.1} KW=Complete proteome; Reference proteome OX=599839 OS=Fibroporia radiculosa. GN=FIBRA_03301 OC=Agaricomycetes; Polyporales; Polyporales incertae sedis; Fibroporia.
Sequence
MDVDALSPSQKDALGQLQALMNGGDADVAIGVLDSVNWDVQRAAEMIFDNGVPPPLSRPG
SRTNIEHFEVDDSEQGLLIPTSSGREFRPVRTPSSGLTVRPVRALIAVITLPLRLITSIL
RFLFRILRVPFPQFVPFTWSSLSYRSHGLGNRHDSRLMDPRSVAERWVRALEEETGAVCI
SRSGARNNLDSSVNDHGVSSGTDAAGPSTLTARMGPNDSTVEDVELKSLPDFFLGSYENF
VRTCEKSAKIGCVILVSEEHDDVPEFKRSTLTDPTLLKLVQENDIIVWGGDIRDKDPWSA
SQKLQATTYPFVAFIALQARRTTGPGTASAPTLTILSRHQGPCIPSTSAPTAAQTLATHL
TDHLLPRVTPFLARIKAQAAERERERALRAEQDRAFEESRQRDKERVERRLAEDKRAEDE
RRLRAEAEEQRRAWHARRMDWRRYERRALVTREPRPGESGRGKTMRVGLRLPDGRRLVRF
FGESDSMTALHAYVDSHFIPAELAPDSDPHAPPGGATPGEIGLVEEVQSSGRSETQWWGF
QLVLAYPRKELAWEPSRRLGDVDVLKSGGQLVVEMVGDMGSGDGKGKEKAAAAENSDDGY
ETED
Download sequence
Identical sequences J4HVX1
XP_012180535.1.98339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]