SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J5RUU4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J5RUU4
Domain Number 1 Region: 31-127
Classification Level Classification E-value
Superfamily Histone-fold 6.36e-79
Family Nucleosome core histones 0.00000717
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J5RUU4
Sequence length 131
Comment (tr|J5RUU4|J5RUU4_SACK1) Histone H2B {ECO:0000256|RuleBase:RU000451} KW=Complete proteome; Reference proteome OX=226230 OS=8840 / NBRC 1802 / NCYC 2889) (Yeast). GN=SKUD_137904 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces.
Sequence
MSAKAEKKPASKAPAEKKPAAKKTSTSTDGKKRSKARKETYSSYIYKVLKQTHPDTGISQ
KSMSILNSFVNDIFERIATEASKLAAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTR
AVTKYSSSTQA
Download sequence
Identical sequences A0A0L8VTA7 A0A250W9E2 A6ZYH8 B3LG63 C7GVC8 E7KB07 E7LSX7 E7NFW7 E7Q2B4 E7QD15 G2WAW9 H0GSY3 J5RUU4 N1P503 P02293
tr|A6ZYH8|A6ZYH8_YEAS7 4kud_D 4kud_H 6gej_G 6gej_H 6gen_G 6gen_H YDR224C YDR224C YDR224C YDR224C SCRT_00300 YDR224C YDR224C YDR224C YDR224C YDR224C ORFP:4582 YDR224C YDR224C YDR224C YDR224C YDR224C YDR224C YDR224C YDR224C NP_010510.3.97178 YDR224C YDR224C 4932.YDR224C ORFP:4084 YDR224C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]