SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J7EJ71 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J7EJ71
Domain Number 1 Region: 21-126
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 2.09e-40
Family Chemosensory protein Csp2 0.0000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J7EJ71
Sequence length 130
Comment (tr|J7EJ71|J7EJ71_ADELI) Chemosensory protein 1 {ECO:0000313|EMBL:ACZ58019.1} OX=236346 OS=Adelphocoris lineolatus (Alfalfa plant bug). GN= OC=Panheteroptera; Cimicomorpha; Miridae; Mirini; Adelphocoris.
Sequence
MLKVLVLLAAVVCCVSAAATYTSKYDNIDLDEILSNTRLYKKYFDCLANKGKCTPDGKEL
KESLPDALKTNCAKCTKKQQEGTDKVFRHVLKNKPNDYKVLESIYDPPGIYRKKYEAEAE
KRGIKLPGSH
Download sequence
Identical sequences J7EJ71

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]