SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J7LQA4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J7LQA4
Domain Number 1 Region: 1-210
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.75e-47
Family Thioltransferase 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J7LQA4
Sequence length 232
Comment (tr|J7LQA4|J7LQA4_9MICC) Putative DSBA-like thioredoxin domain protein {ECO:0000313|EMBL:AFR27587.1} KW=Complete proteome OX=1118963 OS=Arthrobacter sp. Rue61a. GN=ARUE_c06530 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Arthrobacter.
Sequence
MKIEIWSDVACPWCYIGKRRFETALAQFPHRDSVDIEWKSYQLDPSVPEHYDGTELDYLS
NRKGMAPEQVKQMFAHVTETAKGEGLDYHFDKVVVANSFTAHRLIHLAASHGRQDAAKEQ
LLSDHFEHGKDIGNQEYLTELGASLQLPADEVAELFTSDKYTDAVNQDINEARAIGVTGV
PFFVIDRKYGISGAQPADLFSQALNQAWQEANPLIPVGASDAEACGPDGCAV
Download sequence
Identical sequences A1R2N0 J7LQA4
gi|403525738|ref|YP_006660625.1| WP_011773440.1.67142 WP_011773440.1.83037 290340.AAur_0689 gi|119962002|ref|YP_946492.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]