SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9BBE6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9BBE6
Domain Number 1 Region: 12-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.77e-35
Family G proteins 0.0001
Further Details:      
 
Weak hits

Sequence:  J9BBE6
Domain Number - Region: 185-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.000107
Family SOCS box-like 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9BBE6
Sequence length 280
Comment (tr|J9BBE6|J9BBE6_WUCBA) Ras family protein {ECO:0000313|EMBL:EJW84465.1} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_04627 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
MRIGASELCREEHEYMLKFLLVGDSDVGKDEIADFLRPSVSYTPDALFIPFAVPKTTVIL
LEGKFVRLELWDASGQGRFSTIIKSYSRGVQGILLVYDITNRWSFDGIRRWLAEIDEHAP
GVPKILIGNRLHLEFNRAVPRREAECFARKRNMQYFEISTLAYFNVHESITELARLVISR
NGMHRLWKCAQVASLQDLCCRAIIKNISNVHAIDRLLLPSFLQLKVRSFASGTDLCMRSV
IRRQYATPYFSSASKYITRFVRARDTSTKDHLRKANCDLM
Download sequence
Identical sequences J9BBE6
WUBG_04627T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]