SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9E1Z4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9E1Z4
Domain Number 1 Region: 209-325
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000183
Family YWTD domain 0.00056
Further Details:      
 
Domain Number 2 Region: 28-68
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 155-202
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000533
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 4 Region: 79-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 1-28
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000497
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 127-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000547
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9E1Z4
Sequence length 331
Comment (tr|J9E1Z4|J9E1Z4_WUCBA) Uncharacterized protein {ECO:0000313|EMBL:EJW76158.1} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_12932 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
CANKHCIHASWECDGDNDCLDGSDEHPNCTYSQCQSEFWQCANNKCIPNSWKCDGNDDCD
DGSDEKDCTDKSASSSSITNSCPVGQFRCSSGECIAETKVCDRVYDCSDRSDESSKCFIN
ECTSAEKALCEQKCVDLPIDYRCDCFDGFALDKDDKKSCHDIDECETGLGQCSQKCENKI
GTYKCWCTDGYAISSDDRTCKRVSTDPEPWLLFANKHYIRKLTLDGENYELVARGFENVI
SMDIDMKERKVYLVDSGKLRLYRVSMEELDQPIDSYEVVLRHNVFGTEGIAIDWIGRKLY
MLNRQERSLRVCELDGRYCRTLIRDRIAQPK
Download sequence
Identical sequences J9E1Z4
WUBG_12932T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]