SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9EEP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9EEP6
Domain Number 1 Region: 62-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000067
Family Laminin-type module 0.025
Further Details:      
 
Domain Number 2 Region: 6-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family Laminin-type module 0.012
Further Details:      
 
Weak hits

Sequence:  J9EEP6
Domain Number - Region: 163-209
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.0785
Family SNARE fusion complex 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9EEP6
Sequence length 279
Comment (tr|J9EEP6|J9EEP6_WUCBA) Uncharacterized protein {ECO:0000313|EMBL:EJW75502.1} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_13590 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
KGCEPCECDPTGVILSDNGMPQLQCNELDGRCYCKPGRGGRTCSDCEDYHWGDPATGECR
KCECDRIGSATQQCDRNNGSCVCLPGSGGPLCNMCARGYTGQWPQCQACGECFQNWDEII
QNLRSQVEVLIETAKNVEDTGVASVYDNEFEKWKTINLKKELLNSVGGRITEISSNVDGA
DLELKSLVEEADRLTEKSQAFQENATLLRVADIQGAYNITRESAEKSSAAKLRTDQADLK
ITSAESSRQEATQLLDNNQLDFEKQFSENEMALVRIDKQ
Download sequence
Identical sequences J9EEP6
WUBG_13590T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]