SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9EHL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9EHL7
Domain Number 1 Region: 96-162
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000121
Family Ovomucoid domain III-like 0.007
Further Details:      
 
Domain Number 2 Region: 170-229
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000166
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 3 Region: 37-91
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000665
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 4 Region: 430-503
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000554
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 5 Region: 322-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000137
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 6 Region: 260-310
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000608
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Weak hits

Sequence:  J9EHL7
Domain Number - Region: 374-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000179
Family Laminin-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9EHL7
Sequence length 593
Comment (tr|J9EHL7|J9EHL7_WUCBA) Kazal-type serine protease inhibitor domain-containing protein {ECO:0000313|EMBL:EJW81976.1} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_07113 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
MRRSACMSKIQNAVRHAGPCGFGVCAGYDGCRPFEVCIDRDGHPVCECEACDSQLNEVCA
SDGITYANECKMRLESCLTNKFIYQKYSGVCDGCVNVHCEFYAICVSDEAGGGSCRCPNQ
CAYDDSGIVCATDGVTYLSECHMRQAACQQQKFIVIAFRGPCDSCSNIACLDEQQCEESI
CSCPSSCPNTTENSTVCGTDGILYPSKCHLKMAICHSGSEISVQNLNNCKQTLPKIGEFS
VMSRCDQQSCFFWEICAVLTENRCMFCDFNCSARNDMGAICGFCSDGETYNSTCFMDLAS
CKQQKPIYQMTQIHLCHYYDECSCNRVGSYSNMCDQHGQCRCLPGVSGRKCDHCASGFWG
LHLIAKGALGCQPCGCSVFGSSRFDCEQSSGRCQCKSDSYGIKCDACDPDSVLTSSGCLK
RAEFHAPKDCNELRCHHGAVCLIASSGMPICKCSKQCSLDHLGIVAEMTICGSDGNTYDN
ICELQQFACLHQLDLVPSTLGICSQDGSDGNSEMQRRRERKLDTMPILGNLCVDDTDCHV
FNTYCGQVNFLGLKNCKCREGFLPSKDMTQCIQGKRVFFILLPDVNQCFQNKL
Download sequence
Identical sequences J9EHL7
WUBG_07113T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]