SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9EJR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9EJR8
Domain Number 1 Region: 69-327
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-50
Family YWTD domain 0.00000886
Further Details:      
 
Domain Number 2 Region: 645-881
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-31
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 3 Region: 403-590
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-27
Family YWTD domain 0.00022
Further Details:      
 
Domain Number 4 Region: 335-366,602-638,907-957
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000345
Family Growth factor receptor domain 0.024
Further Details:      
 
Domain Number 5 Region: 18-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000456
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9EJR8
Sequence length 1072
Comment (tr|J9EJR8|J9EJR8_WUCBA) Uncharacterized protein {ECO:0000313|EMBL:EJW82691.1} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_06399 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence
MKIYNEKKILQLVNKTKCEPENECLDARSCSQNCTDEKHGFTCSCEEGYTLDADKRTCKV
TDGVQDMRIYVSNRNRIYWSDRFLENWHTFEARVENAIALAWDSVEDRIYWSDIREKKIY
SATRNGTNVTVFISEGLDVTEGIALDWIARNLYWVDSSLNTIEVASLERSDARAVLIHEN
VDQPRGIAVDPRKGLLFWTDWGQNPRIERANMDGSERRVLVNSKIYWPNTIALDLTTNRL
YFADSKLDYIDFVDYDGNGRTQVLSSTKFVQHPHALAIFEDIIYYSDRRLQRLQLYPKYP
NGTSTEYQSHTFSKALGVTAVHPVLQPHFENPCATNPCSDLCLIGKICTCKCPLGKILDT
SGKNCISDMKPFLMLIQKTNIFGLSMDDAVNGTPSLSGMIPLAGLSNAYDADYDPESAEI
IASQIPDDPYAMAMDWIGQNMYVANKISQTIEVVRTKDMQYRATVLNNNLSPTAVANPVA
LAIDSDRGLLFWLDRGSGAISPKVARADLDGKNALVIVSNDLTELNHLALDTINQRLYFS
ESKAGRISYVTYDGQDRHYILNDVGKQPRGIAFFNNQLFYADSAFDSIEVTLLSNDAEHS
HPCRTNNGNCEHLCIPKAFSQHYCMCATGYVLESATHCRLFDQSFLIVATKTQVTGIPLK
EEQKRSIAMEPIGGTSIAAVDFEFESKSLFVAETSGPNRGIYKVILGSGEVNNIVRDNFG
SFTVRSIALDWINYNLYFINVDSDRTHIEVCQLDGKHRKILLSTKTETPTSLAVDPIGRY
LYWADQGQKPSIQRAFLDGSHRQVIVHENIAEPTDLIIDSNSHMIYWTDAKLDGIYRVRA
DGGPVELVRSDIAAAAGIALLGQTMYWTDNRLEKVFSASSSPNQTSLLLSPTTIAAGLTD
LGNVVVFDESVQPKASSPCQITDNLRKTPCAQLCFASPGSQSPLCACARGVLKGRSCEEP
ETFLMFADGNHIVDTPIEPDVKAPNPLKEALPQIENLQTFDVDVNLRRIYMVTESANGAN
ISWFTINQPAKRRLIFGPTRSKLADSVRHISDMKLDWLTHKYISQLAGALFS
Download sequence
Identical sequences J9EJR8
WUBG_06399T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]