SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9JRK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9JRK2
Domain Number 1 Region: 102-398
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 1.25e-33
Family NodB-like polysaccharide deacetylase 0.052
Further Details:      
 
Domain Number 2 Region: 29-88
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000000000000201
Family Tachycitin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9JRK2
Sequence length 479
Comment (tr|J9JRK2|J9JRK2_ACYPI) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:ACYPI002929-PA} KW=Complete proteome; Reference proteome OX=7029 OS=Acyrthosiphon pisum (Pea aphid). GN=LOC100161729 OC=Aphidomorpha; Aphidoidea; Aphididae; Macrosiphini; Acyrthosiphon.
Sequence
MDFALKVIAVIAIYFCPIVLCETAEETFVCPEVGGNGNYADPATCRRFYQCVDNFPYLNR
CPAGLYFDDVNKLCTFKNEARCGPLPSTEAPSTENPIDLAPKCDTSQCTLPYCFCSRDGT
IIPGGLDPKETPQMILLTFDGALNQNNYDHYQKVFSHNKKNPNGCLIKGTFFISHEYCDY
NMVQEIAHKGHEIAVETVSLQKGLHDKGYEEWVAEMIGMREILVNFANLTKSDIVGMRAP
FLKPGRNTQYEVIEDYGFVYDSSIGIPPSRVPIWPYSLDYKIPHECKSGTCPTKSFKGTW
EVPLNAHYVATYEGGHCPYLDQCVLHSHDANEVFEWLREDFERYYSQNRAPYMMPFHTNW
FQIKELEDGLHKFIDWANKQPDVWFVTTTQALTWMTDPKTTKDLSGFEPWMCDKPDQLPS
PPCNLPNKCQLSFKHPETNVVGTRYLSTCKECPRKYPWLGDSKGTGVAGADVYSPDNLK
Download sequence
Identical sequences J9JRK2
gi|193652401|ref|XP_001951879.1| XP_001951879.1.67334

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]