SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9NSP3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9NSP3
Domain Number 1 Region: 105-306
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000706
Further Details:      
 
Domain Number 2 Region: 20-105
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-24
Family Pleckstrin-homology domain (PH domain) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) J9NSP3
Sequence length 611
Comment (tr|J9NSP3|J9NSP3_CANLF) Rho GTPase activating protein 22 {ECO:0000313|Ensembl:ENSCAFP00000040583} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=ARHGAP22 OC=Canis.
Sequence
MLSPKIRQARRARSKSLVMGEQSRSPGRLPCPHRLGPVLKEGWLKKQRSIMKNWQQRWFV
LRGDQLFYYKDKDETKPQGFISLQGTRVTELLPGPEDAGKHLFEIGPGIFGQRLEDTVHH
ERKYGPRLAPLLVEQCVDFIREHGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTD
VHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSSLPLANYNL
LRYICKFLDEVQSHSNVNKMSVQNLATVFGPNILRPQIEDPVTIMEGTSLVQHLMTVLIH
RHGQLFAARAEEGLAAPRGGPPCAVSWGSGEVPGGAPPEPGSPGTPGLPSHRTSSPDGAT
VAALSRTSPTGLGGRGSPVATSPGKRVQTLPSWKSSSRQSGSRPGSPKGGASSLEGPIIS
GGNRLADGLSSLRGPRRASAGERLKGCSSAQRLSTYDNVPPPGGPAPRTXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXGPRAPRRRQQQGGPPGSRAGPWPGRGGRPRRRRRAQR
PRRPDPGLRPLLRGSPGPGRGAQGTAVPAEDRVRHEYQKVKGCGPGASARLAPPGPGRAL
VVVGLRSRLRF
Download sequence
Identical sequences J9NSP3
ENSCAFP00000040583 ENSCAFP00000040583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]