SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9NTY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9NTY4
Domain Number 1 Region: 68-406
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.28e-80
Family Protein kinases, catalytic subunit 0.0000028
Further Details:      
 
Domain Number 2 Region: 873-923
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000015
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0065
Further Details:      
 
Domain Number 3 Region: 938-1069
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000086
Family Pleckstrin-homology domain (PH domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9NTY4
Sequence length 1547
Comment (tr|J9NTY4|J9NTY4_CANLF) Non-specific serine/threonine protein kinase {ECO:0000256|SAAS:SAAS01030073} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=CDC42BPG OC=Canis.
Sequence
MERRLRALERLARGEAGGGPGLDGLLDLLLGLHHELSSAPLRRERNVAQFLSWASPFVAK
VKELRLQRDDFEILKVIGRGAFGEVAVVRQRDSGQIFAMKMLHKWEMLKRAETACFREER
DVLVKGDSRWVTALHYAFQDEEFLYLVMDYYAGGDLLTLLSRFEDRLPPELAQFYLAEMV
LAIHSLHQLGYVHRDVKPDNVLLDMNGHIRLADFGSCLRLNNSGMVDSSVAVGTPDYISP
EILQAMEEGKGHYGPQCDWWSLGVCAYELLFGETPFYAESLVETYGKIMNHEDHLQFPSD
VPDVPATAQDLIRRLLCRQEERLGRGGLDDFRNHPFFEGVDWEQLATSTAPYIPELRGPM
DTSNFDVDDDTLNEPGTLPPPSHGAFSGHHLPFVGFTYTSSSPGPESSSEQLAALEQKLH
CLEQEKMELSRKLQEALQVSSDHWELERLRKEVQTLQGRLSETPRDGEAEMDGSSPGQNC
NLWQERDRLVQELAEAQAGLRAQSQELCRAQERQEELLQRLQEAQEREAATASQTQALSS
QLEEAQDTSRKLQAQVTTLCREVTQLQRQWERSLEKESFRVKTIHMASETNGTGLPEGGP
QEAQLRKEVAALRMQLEAAHSHGLSGKEETLCWLQEENRRLSLEQERLVEELEREQQSKQ
QLEGERRETESNWEAQIADILSWVNDEKVSRGYLQALATKMAEELESIRNVGTQTLPARP
LDHQWKARRLQKMEASARLELQSALEAEIRAKQSLQEQLTHMQEAQLQAESRLQEAQKQS
QGLQQELAALREELAARGPGDAKSSNSLIPFRSLWSSEKDSSKDPGISGEDLRPSVEPEL
RPEGRRSLRLGAVFPRVPAAPTAPAEGPPAKPGSHALRPRSFPSPTKCLLCTSLMLGLGR
QGLGCDACGYFCHSACVPQAPPCPVPPDHLRTALGVHPETGTGTAYEGFLSVPRPSGVRR
GWQRVFAALSDSRLLLFDAPDPRLSPASGALLQALDLRDPQFSATPVLASDVIHAQTRDL
PRIFRVTASQLMVPPAVCTVLLLAESEAERERWLQVLGELQRLLLDSRPRPRPVYTLKEA
YDNGLPLLPHALCAAIIDQERLALGTEEGLFVIHLHSNDIFQVGECRRVQRLAVSPMAGL
LVVLCGRGPSVRLFALAKLESAEVVGAKIPESRGCQALAAGRILQARTPVLCVAVKRQVL
CYQLGPGPGPWQRRIRELQAPAPVQSLGLLGDRLCVGAAGAFALYPLLNEAAPLPLGASL
VPEELPPSRGGLGEALGAVELSLSEFLLLFTTAGVYVDSAGRKSRVHELLWPAVPTGWGY
AAPYLTVFSENSIDVFDVRKTEWVQTVPLKKVRPLNPEGSLFLFGTEKVRLTYLRNRLAE
KDEFDIPDLTDNSRRQLFRTKSKRHFSFRVSEEQRQQRRREMLKDPFVRSKLISPPTNFN
HLVHVGPTDGKPGARTQPPAPEGKGRGSRGSGPQRPHSFSEASRRPASVGSDGLAGDADA
RKRKPWTSLSSESVSCPQGSLSPADSLIQVSERPRSLPPAPESEGSP
Download sequence
Identical sequences J9NTY4
XP_540878.3.84170 ENSCAFP00000020873 ENSCAFP00000036621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]