SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9NWB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9NWB6
Domain Number 1 Region: 979-1109
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.68e-46
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 29-158
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-22
Family Synaptotagmin-like (S variant) 0.004
Further Details:      
 
Domain Number 3 Region: 189-270
Classification Level Classification E-value
Superfamily PDZ domain-like 2.93e-17
Family PDZ domain 0.0000143
Further Details:      
 
Domain Number 4 Region: 448-551
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000225
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) J9NWB6
Sequence length 1115
Comment (tr|J9NWB6|J9NWB6_CANLF) Regulator of G protein signaling 3 {ECO:0000313|Ensembl:ENSCAFP00000037461} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=RGS3 OC=Canis.
Sequence
MEWQGQHTSVLRKDAWMQTTPARRRIRHIQVQGAGQLKLSIDARDRVLLLHIIEGKGLMS
REPGICDPYVKISLIPEDNRLRRQKTQTVPDCREPVFHEHFFFPVQEEDEQKRLLVTVWN
RAGDSRQSGLIGCMSFGVKSLLTPDKEISGWYYLLGEDLGRTKHLKVARRRLRPLRDPLL
RTPGCGDAENGEKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQL
NERPVEHWKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPN
KREKNCTHGAQARPEQRHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAST
DPNYIILAPLNPGSQLLRPVYQEDAIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGN
YQNCPVMRPHAPHSSYGTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKA
VEVTLFAYSDLLLFTKEDEPGRCNVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLF
TLEAHSQEQKKRVCWCLSENIAKQQQLAASPLESKGWKAEATKEEGTHLGSAESPMNLNL
RSTCCDLPHLTTCSAYPKNKASTTRKSQMFEPEADEKREMPLEEGKGLGAEDPPPSKDPS
PGQESPSGQDVPPNKDSSSGEEPSPGQESLSSKDSPSCKEPPPGQEASPSKDSPPCQEPP
AAPALPPCQDLPAGQEPPPSQDLPVTQDASAQEPAPSQDVPPSQVPPPAEETASSGDPPA
ASGDPPVAPRPTFVIPEVRLDSAYSQKAGAEGGSPAEEEEDAEEAEEGDEGDEEEEEEDD
TSDDNYGERREAKRSSMIEGGQAEGGLSLRVQNSLRRRTHSEGSLLQEARGPCFASDTTL
HCSERGRAPRPHGPCLRPAPSRRNWAATVAPCTTSPSFSQDTGRAKDMKNKLGIFRRRNE
SPGAQPAGKADKMVKSFKPTSEEALKWGESLEKLLLHKYGLAVFQAFLRTEFSEENLEFW
LACEDFKKVKSQSKMAAKAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLA
QKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL
Download sequence
Identical sequences J9NWB6
ENSCAFP00000037461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]