SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for J9NWL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  J9NWL7
Domain Number 1 Region: 2180-2480
Classification Level Classification E-value
Superfamily BEACH domain 3.27e-130
Family BEACH domain 0.0000000000165
Further Details:      
 
Domain Number 2 Region: 2589-2839
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.86e-34
Family WD40-repeat 0.0069
Further Details:      
 
Domain Number 3 Region: 186-371
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.07e-31
Family Clostridium neurotoxins, the second last domain 0.013
Further Details:      
 
Domain Number 4 Region: 2069-2174
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-28
Family PreBEACH PH-like domain 0.00000262
Further Details:      
 
Domain Number 5 Region: 466-570,649-950
Classification Level Classification E-value
Superfamily ARM repeat 1.85e-19
Family Mo25 protein 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) J9NWL7
Sequence length 2854
Comment (tr|J9NWL7|J9NWL7_CANLF) LPS responsive beige-like anchor protein {ECO:0000313|Ensembl:ENSCAFP00000037562} KW=Complete proteome; Reference proteome OX=9615 OS=Canis lupus familiaris (Dog) (Canis familiaris). GN=LRBA OC=Canis.
Sequence
MASEDNNVPSPPPTGDDGGGGGKEETAAEESALSLKPGLPIRGIRMKFAVLTGLVEVGEV
SNRDIVETVFNLLVGGQFDLEMNFIIQEGESIICMVDLLEKCDITCQAEVWSMFTAILKK
SIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSKLQGDK
GQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIAKWPYQNGFTFHTWLRMD
PVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFDFKPQKWY
MVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETADANRVFCGQ
MTAVYLFSEALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDGKLSSAIAFT
YNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLF
AQLDYRQYLSDEVDLTICSTLLAFIMELLKNSIAMQEQMLACKGFLVIGYSLEKSSKSHV
SRAVLELCVAFSKYLSNLQNGMPLLKQLCDHILLNPAIWIHTPAKVQLTLYTYLSTEFIG
TVNIYNAIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPNQKEILSLRAFLLM
FIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMSEHPNSMIPAFDQRNG
LRVIYKLMASTSEGIRVQALKAMGYFLKHLAPKRKAEIMLGHGLFSLLAERLMLQTNLIT
MTTYNVLFEILIEHICTQVIHKQHPDPDSSVKIQNPQILKVIATLLRNSPQCSESMEVRR
AFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDEQKITEMVYAIFRILLYH
AVKYEWGGWRVWVDTLSITHSKVTFEMHKENLASMFREHQGKVDEQIGQCSNSLEADSAI
SRDVNVSVASQQTSMKACPVSPHNTRNSDEKSTIEKTVSVDSVSSVGLPTPNASNEERQT
GQESQELLDEVHLEETLINETINTGDLEVSSDTIDAETVSSNSFKMSCKNIMTISEVTAS
VSSPSEEDTSEVPEFLDKSIVEEDDDDYVELKVESSPTEEASLPTELQEDSLSPAASEAS
ERLDMLSNDNKLVFQEQESVSKKQSDSETQDSKDSGILTMTASGSSATSPDIIVSQTPVQ
SDVGEMLQEGKKTTSFARETKVVGDSPVFEAPTTSEQRIAKLDVSSVATDTERLELKANT
NMETSQPHQPVLEVSRQQEEPGQGIVPDGVNGQRRDSRSAMFRIPEFKWSQMHQRLLNDL
LFAIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTIHLISQVMDNMVMACGGILPLLSAA
TSATHELENIEPTQGLSIEASVTFLQRLISLVDVLIFASSLGFTEIEAEKNMSSGGILRQ
CLRLVCAVAVRNCLECQQHSQLKARGDTVRGQKTMHSLIPMGKSAAKSPVDIVTGGISPV
RDFEKLLQDMDINRLRAVVFRDIEDSKQAQFLALAVVYFISVLMVSKYRDILEPQNERRN
QSFKETGSESGNLSLPGVENTPSAFSPLTPASVEESESTSSTRRRDSGLGEETAVGLGNS
VDVVPPVTPPSVSAGPDAISEALCTLSLEVNKSQETKNDGGNELDNKAAPSVPVSKNVNV
KDILRSLVNIPGDGVTVDPALLPPACLGALGDLSVEQPVQFRSFDRSVIISTKKSAVLPS
TLTTSLPTNAVSVVSSVDSTQTSDGGGESPGGRSSNAKLPSVPTVGSVTSDQVSNMSITE
RLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQELLIEGTSLVCMKSSSSVVELVMLLC
SQEWQNSIQKNAGLAFIELVNEGRLLSQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFE
SLCAQYSADKREDEKMCDHLIRAAKYRDHVTATQLIQKIINILTDKHGAWGNSAVSRPRE
FWRLDYWEDDLRRRRRFVRNPLGSTHPEATLKTAVEHAADEDILAKGKQSIKSQALGNQN
SENEILLEGDDDTLSSVDEKDLENLAGPVSLSTPAQLVAPSIVVKGTLSVTSSELYFEVD
EEDSNFKKIDPKILAYTEGLHGKWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPD
PATVKKVVNYLPRVGIGTSFGLPQTRRISLASPRQLFKASNMTQRWQHREISNFEYLMFL
NTIAGRSYNDLNQYPVFPWVITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERYE
SWEDDQVPKFHYGTHYSTASFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSISRAWRN
CQRDTSDIKELIPEFYYLPEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRL
ALESEFVSCQLHQWIDLIFGYKQQGPEAVRSLNVFYYLTYEGAVNLNSIADPILREAVEA
QIRSFGQTPSQLLIEPHPPRGSAMQVSPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQP
GLATPAVITVTANRLFAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIASNTGMHRRQITDL
LDQSIQVHSQCFVITSDNRYILICGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLTRSES
YIGGNCYILSGSRDATLLLWYWNGKSSGIGDNPGSETTTPRAILTGHDYEITCAAVCAEL
GLVLSGSKEGPCLIHSMNGDLLRTLEGPENCLRPKLIQASREGHCVIFYENGCFCTFSVN
GKLQATMETDDNIRAIQLSRDGQYLLTGGDSGVLMVWQVSDLKHLFAYPGCDAGIRAMAL
SYDQRCIISGMASGSIVLFYNDFNRWHHEYQTRY
Download sequence
Identical sequences J9NWL7
ENSCAFP00000037562 XP_013974843.1.84170 ENSCAFP00000011756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]